MAS1L (Human) Recombinant Protein
  • MAS1L (Human) Recombinant Protein

MAS1L (Human) Recombinant Protein

Ref: AB-H00116511-G01
MAS1L (Human) Recombinant Protein

Información del producto

Human MAS1L full-length ORF (NP_443199.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name MAS1L
Gene Alias MAS-L|MGC119987|MRG|dJ994E9.2
Gene Description MAS1 oncogene-like
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MVWGKICWFSQRAGWTVFAESQISLSCSLCLHSGDQEAQNPNLVSQLCGVFLQNETNETIHMQMSMAVGQQALPLNIIAPKAVLVSLCGVLLNGTVFWLLCCGATNPYMVYILHLVAADVIYLCCSAVGFLQVTLLTYHGVVFFIPDFLAILSPFSFEVCLCLLVAISTERCVCVLFPIWYRCHRPKYTSNVVCTLIWGLPFCINIVKSLFLTYWKHVKACVIFLKLSGLFHAILSLVMCVSSLTLLIRFLCCSQ
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 116511

Enviar un mensaje


MAS1L (Human) Recombinant Protein

MAS1L (Human) Recombinant Protein