PAQR8 (Human) Recombinant Protein
  • PAQR8 (Human) Recombinant Protein

PAQR8 (Human) Recombinant Protein

Ref: AB-H00085315-G01
PAQR8 (Human) Recombinant Protein

Información del producto

Human PAQR8 full-length ORF (NP_588608.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name PAQR8
Gene Alias C6orf33|FLJ32521|FLJ46206|LMPB1|MPRB
Gene Description progestin and adipoQ receptor family member VIII
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MTTAILERLSTLSVSGQQLRRLPKILEDGLPKMPCTVPETDVPQLFREPYIRTGYRPTGHEWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFWAFAEAEALPWASTHSLPLLLFILSSITYLTCSLLAHLLQSKSELSHYTFYFVDYVGVSVYQYGSALAHFFYSSDQAWYDRFWLFFLPAAAFCGWLSCAGCCYAKYRYRRPYPVMRKICQVVPAGLAFILDISPVAHRVALCHLAGCQEQAAWYHTLQILFF
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 85315

Enviar un mensaje


PAQR8 (Human) Recombinant Protein

PAQR8 (Human) Recombinant Protein