OR2C3 (Human) Recombinant Protein
  • OR2C3 (Human) Recombinant Protein

OR2C3 (Human) Recombinant Protein

Ref: AB-H00081472-G01
OR2C3 (Human) Recombinant Protein

Información del producto

Human OR2C3 full-length ORF (NP_932340.2) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name OR2C3
Gene Alias OR2C4|OR2C5P|OST742
Gene Description olfactory receptor, family 2, subfamily C, member 3
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MEIANVSSPEVFVLLGFSARPSLETVLFIVVLSFYMVSILGNGIIILVSHTDVHLHTPMYFFLANLSFLDMSFTTSIVPQLLANLWGPQKTISYGGCVVQFYISHWLGATECVLLATMSYDRYAAICRPLHYTVIMHPQLCLGLALASWLGGLTTSMVGSTLTMLLPLCGNNCIDHFFCEMPLIMQLACVDTSLNEMEMYLASFVFVVLPLGLILVSYGHIARAVLKIRSAEGRRKAFNTCSSHVAVVSLFYGSI
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 81472

Enviar un mensaje


OR2C3 (Human) Recombinant Protein

OR2C3 (Human) Recombinant Protein