Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
CD276 (Human) Recombinant Protein
Abnova
CD276 (Human) Recombinant Protein
Ref: AB-H00080381-H01
CD276 (Human) Recombinant Protein
Contáctenos
Información del producto
Purified CD276 (AAH62581.1 28 a.a. - 238 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
Información adicional
Size
25 ug
Gene Name
CD276
Gene Alias
B7-H3|B7H3
Gene Description
CD276 molecule
Storage Conditions
Store at -80C. Aliquot to avoid repeated freezing and thawing.
Concentration
&ge
Application Key
WB,ELISA,SDS-PAGE,PI
Immunogen Prot. Seq
ALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTIT
Form
Liquid
Antigen species Target species
Human
Quality control testing
SDS-PAGE and Western Blot
Storage Buffer
100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Host
Human HEK293T cells
Gene ID
80381
Enviar un mensaje
CD276 (Human) Recombinant Protein
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*