KIAA0319L (Human) Recombinant Protein
  • KIAA0319L (Human) Recombinant Protein

KIAA0319L (Human) Recombinant Protein

Ref: AB-H00079932-G01
KIAA0319L (Human) Recombinant Protein

Información del producto

Human KIAA0319L full-length ORF (AAH14530.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name KIAA0319L
Gene Alias KIAA1837|PKD1-like|PP791|RP4-765A10.3
Gene Description KIAA0319-like
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MEKRLGVKPNPASWILSGYYWQTSAKWLRSLYLFYTCFCFSVLWLSTDASESRCQQGKTQFGVGLRSGGENHLWLLEGTPSLQSCLAACCQDSACHVFWWLEGMCIQADCSRPQSCRAFRTHSSNSMLVFLKKFQTADDLGFLPEDDVPHLLGLGWNWASWRQSPPRAALRPAVSSSDQQSLIRKLQKRGSPSDVVTPIVTQHSKVNDSNELGGLTTSGSAEVHKAITISSPLTTDLTAELSGGPKNVSVQPEIS
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 79932

Enviar un mensaje


KIAA0319L (Human) Recombinant Protein

KIAA0319L (Human) Recombinant Protein