Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
MANEA (Human) Recombinant Protein
Abnova
MANEA (Human) Recombinant Protein
Ref: AB-H00079694-G01
MANEA (Human) Recombinant Protein
Contáctenos
Información del producto
Human MANEA full-length ORF (NP_078917.2) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size
10 ug
Gene Name
MANEA
Gene Alias
DKFZp686D20120|ENDO|FLJ12838|hEndo
Gene Description
mannosidase, endo-alpha
Storage Conditions
Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key
AP
Immunogen Prot. Seq
MAKFRRRTCIILALFILFIFSLMMGLKMLRPNTATFGAPFGLDLLPELHQRTIHLGKNFDFQKSDRINSETNTKNLKSVEITMKPSKASELNLDELPPLNNYLHVFYYSWYGNPQFDGKYIHWNHPVLEHWDPRIAKNYPQGRHNPPDDIGSSFYPELGSYSSRDPSVIETHMRQMRSASIGVLALSWYPPDVNDENGEPTDNLVPTILDKAHKYNLKVTFHIEPYSNRDDQNMYKNVKYIIDKYGNHPAFYRYK
Form
Liquid
Antigen species Target species
Human
Storage Buffer
25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID
79694
Enviar un mensaje
MANEA (Human) Recombinant Protein
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*