Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
ADIPOR2 (Human) Recombinant Protein (P01)
Abnova
ADIPOR2 (Human) Recombinant Protein (P01)
Ref: AB-H00079602-P01
ADIPOR2 (Human) Recombinant Protein (P01)
Contáctenos
Información del producto
Human ADIPOR2 full-length ORF ( NP_078827.2, 1 a.a. - 386 a.a.) recombinant protein with GST-tag at N-terminal.
Información adicional
Size
2 ug
Gene Name
ADIPOR2
Gene Alias
ACDCR2|FLJ21432|MGC4640|PAQR2
Gene Description
adiponectin receptor 2
Storage Conditions
Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key
ELISA,WB-Re,AP,Array
Immunogen Prot. Seq
MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCVFFLCLGIFYMFRPNISFVAPLQEKVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSGIALLIMGSFVPWLYYSFYCNPQPCFIYLIVICV
Antigen species Target species
Human
Quality control testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID
79602
Enviar un mensaje
ADIPOR2 (Human) Recombinant Protein (P01)
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*