LGR6 (Human) Recombinant Protein
  • LGR6 (Human) Recombinant Protein

LGR6 (Human) Recombinant Protein

Ref: AB-H00059352-G01
LGR6 (Human) Recombinant Protein

Información del producto

Human LGR6 full-length ORF (NP_001017404.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name LGR6
Gene Alias FLJ14471|GPCR|VTS20631
Gene Description leucine-rich repeat-containing G protein-coupled receptor 6
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MRLEGEGRSARAGQNLSRAGSARRGAPRDLSMNNLTELQPGLFHHLRFLEELRLSGNHLSHIPGQAFSGLYSLKILMLQNNQLGGIPAEALWELPSLQSLDLNYNKLQEFPVAIRTLGRLQELGFHNNNIKAIPEKAFMGNPLLQTIHFYDNPIQFVGRSAFQYLPKLHTLSLNGAMDIQEFPDLKGTTSLEILTLTRAGIRLLPSGMCQQLPRLRVLELSHNQIEELPSLHRCQKLEEIGLQHNRIWEIGADTF
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 59352

Enviar un mensaje


LGR6 (Human) Recombinant Protein

LGR6 (Human) Recombinant Protein