JAM2 (Human) Recombinant Protein
  • JAM2 (Human) Recombinant Protein

JAM2 (Human) Recombinant Protein

Ref: AB-H00058494-G01
JAM2 (Human) Recombinant Protein

Información del producto

Human JAM2 full-length ORF (NP_067042.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name JAM2
Gene Alias C21orf43|CD322|JAM-B|JAMB|PRO245|VE-JAM|VEJAM
Gene Description junctional adhesion molecule 2
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MARRSRHRLLLLLLRYLVVALGYHKAYGFSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNISGIIAAVVVVALVISVCG
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 58494

Enviar un mensaje


JAM2 (Human) Recombinant Protein

JAM2 (Human) Recombinant Protein