SLAMF7 (Human) Recombinant Protein
  • SLAMF7 (Human) Recombinant Protein

SLAMF7 (Human) Recombinant Protein

Ref: AB-H00057823-G01
SLAMF7 (Human) Recombinant Protein

Información del producto

Human SLAMF7 full-length ORF (NP_067004.3) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name SLAMF7
Gene Alias 19A|CD319|CRACC|CS1
Gene Description SLAM family member 7
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MAGSPTCLTLIYILWQLTGSAASGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSMVLLCLLLVPLLLSLFVLGLFLWFLKRERQ
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 57823

Enviar un mensaje


SLAMF7 (Human) Recombinant Protein

SLAMF7 (Human) Recombinant Protein