G6PC2 (Human) Recombinant Protein
  • G6PC2 (Human) Recombinant Protein

G6PC2 (Human) Recombinant Protein

Ref: AB-H00057818-G01
G6PC2 (Human) Recombinant Protein

Información del producto

Human G6PC2 full-length ORF (ADR82936.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name G6PC2
Gene Alias IGRP|MGC141936
Gene Description glucose-6-phosphatase, catalytic, 2
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MDFLHRNGVLIIQHLQKDYRAYYTFLNFMSNVGDPRNIFFIYFPLCFQFNQTVGTKMIWVAVIGDWLNLIFKWILFGHRPYWWVQETQIYPNHSSPCLEQFPTTCETGPGSPSGHAMGASCVWYVMVTAALSHTVCGMDKFSITLHRLTWSFLWSVFWLIQISVCISRVFIATHFPHQVILGVIGGMLVAEAFEHTPGIQTASLGTYLKTNLFLFLFAVGFYLLLRVLNIDLLWSVPIAKKWCANPDWIHIDTTP
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 57818

Enviar un mensaje


G6PC2 (Human) Recombinant Protein

G6PC2 (Human) Recombinant Protein