KIR2DL5A (Human) Recombinant Protein
  • KIR2DL5A (Human) Recombinant Protein

KIR2DL5A (Human) Recombinant Protein

Ref: AB-H00057292-G01
KIR2DL5A (Human) Recombinant Protein

Información del producto

Human KIR2DL5A full-length ORF (AAI60063.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name KIR2DL5A
Gene Alias CD158F|KIR2DL5|KIR2DL5.1|KIR2DL5.3
Gene Description killer cell immunoglobulin-like receptor, two domains, long cytoplasmic tail, 5A
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MSLMVISMACVGFFLLQGAWTHEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLGFTIFSLYKEDGVPVPELYNKIFWKSILMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLVIVVTGLFGKPSLSAQPGPTVRTGENVTLSCSSRSSFDMYHLSREGRAHEPRLPAVPSVNGTFQADFPLGPATHGGTYTCFGSLHDSPYEWSDPSDPLLVSVTGNSSSSSSSPTEPSSKTGIRRHLHILIGTSVAIILFIIL
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 57292

Enviar un mensaje


KIR2DL5A (Human) Recombinant Protein

KIR2DL5A (Human) Recombinant Protein