CYSLTR2 (Human) Recombinant Protein
  • CYSLTR2 (Human) Recombinant Protein

CYSLTR2 (Human) Recombinant Protein

Ref: AB-H00057105-G01
CYSLTR2 (Human) Recombinant Protein

Información del producto

Human CYSLTR2 full-length ORF (NP_065110.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name CYSLTR2
Gene Alias CYSLT2|CYSLT2R|GPCR|HG57|HPN321|KPG_011|PSEC0146|hGPCR21
Gene Description cysteinyl leukotriene receptor 2
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MERKFMSLQPSISVSEMEPNGTFSNNNSRNCTIENFKREFFPIVYLIIFFWGVLGNGLSIYVFLQPYKKSTSVNVFMLNLAISDLLFISTLPFRADYYLRGSNWIFGDLACRIMSYSLYVNMYSSIYFLTVLSVVRFLAMVHPFRLLHVTSIRSAWILCGIIWILIMASSIMLLDSGSEQNGSVTSCLELNLYKIAKLQTMNYIALVVGCLLPFFTLSICYLLIIRVLLKVEVPESGLRVSHRKALTTIIITLII
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 57105

Enviar un mensaje


CYSLTR2 (Human) Recombinant Protein

CYSLTR2 (Human) Recombinant Protein