SLC17A7 (Human) Recombinant Protein (P01)
  • SLC17A7 (Human) Recombinant Protein (P01)

SLC17A7 (Human) Recombinant Protein (P01)

Ref: AB-H00057030-P01
SLC17A7 (Human) Recombinant Protein (P01)

Información del producto

Human SLC17A7 full-length ORF ( AAH59379.1, 1 a.a. - 560 a.a.) recombinant protein with GST-tag at N-terminal.
Información adicional
Size 2 ug
Gene Name SLC17A7
Gene Alias BNPI|VGLUT1
Gene Description solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 7
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MEFRQEEFRKLAGRALGKLHRLLEKRQEGAETLELSADGRPVTTQTRDPPVVDCTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTHRGGHVVVQKAQFSWDPETVGLIHGSFFWGYIVTQIPGGFICQKFAANRVFGFAIVATSTLNMLIPSAARVHYGCVIFVRILQGLVEGVTYPACHGIWSKWAPPLERSRLATTAFCGSYAGAVVAMPLAGVLVQYSGWSSVFYVYGSFGIFWYLFWLLV
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 57030

Enviar un mensaje


SLC17A7 (Human) Recombinant Protein (P01)

SLC17A7 (Human) Recombinant Protein (P01)