ACKR3 (Human) Recombinant Protein
  • ACKR3 (Human) Recombinant Protein

ACKR3 (Human) Recombinant Protein

Ref: AB-H00057007-G01
ACKR3 (Human) Recombinant Protein

Información del producto

Human ACKR3 full-length ORF (NP_064707.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name CXCR7
Gene Alias CMKOR1|GPR159|RDC1
Gene Description chemokine (C-X-C motif) receptor 7
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLYTLSFIYIFIFVIGMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVLTIPVWVVSLVQHNQWPMGELTCKVTHLIFSINLFGSIFFLTCMSVDRYLSITYFTNTPSSRKKMVRRVVCILVWLLAFCVSLPDTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVVLGFAVPFSIIAVFYFLLARAISASSDQEKHSSRKIIF
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 57007

Enviar un mensaje


ACKR3 (Human) Recombinant Protein

ACKR3 (Human) Recombinant Protein