SULF2 (Human) Recombinant Protein (P02) Ver mas grande

SULF2 (Human) Recombinant Protein (P02)

AB-H00055959-P02

Producto nuevo

SULF2 (Human) Recombinant Protein (P02)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 2 ug
Gene Name SULF2
Gene Alias DKFZp313E091|FLJ90554|HSULF-2|KIAA1247|MGC126411
Gene Description sulfatase 2
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MGPPSLVLCLLSATVFSLLGGSSAFLSHHRLKGRFQRDRRNIRPNIILVLTDDQDVELGSMQVMNKTRRIMEQGGAHFINAFVTTPMCCPSRSSILTGKYVHNHNTYTNNENCSSPSWQAQHESRTFAVYLNSTGYRTAFFGKYLNEYNGSYVPPGWKEWVGLLKNSRFYNYTLCRNGVKEKHGSDYSKDYLTDLITNDSVSFFRTSKKMYPHRPVLMVISHAAPHGPEDSAPQYSRLFPNASQHITPSYNYAPN
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 55959

Más información

Human SULF2 full-length ORF ( NP_061325.1, 1 a.a. - 870 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

SULF2 (Human) Recombinant Protein (P02)

SULF2 (Human) Recombinant Protein (P02)