UGT1A3 (Human) Recombinant Protein
  • UGT1A3 (Human) Recombinant Protein

UGT1A3 (Human) Recombinant Protein

Ref: AB-H00054659-G01
UGT1A3 (Human) Recombinant Protein

Información del producto

Human UGT1A3 full-length ORF (AAI66641.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name UGT1A3
Gene Alias UGT1C
Gene Description UDP glucuronosyltransferase 1 family, polypeptide A3
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MATGLQVPLPWLATGLLLLLSVQPWAESGKVLVVPIDGSHWLSMREVLRELHARGHQAVVLTPEVNMHIKEENFFTLTTYAISWTQDEFDRHVLGHTQLYFETEHFLKKFFRSMAMLNNMSLVYHRSCVELLHNEALIRHLNATSFDVVLTDPVNLCAAVLAKYLSIPTVFFLRNIPCDLDFKGTQCPNPSSYIPRLLTTNSDHMTFMQRVKNMLYPLALSYICHAFSAPYASLASELFQREVSVVDILSHASVW
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 54659

Enviar un mensaje


UGT1A3 (Human) Recombinant Protein

UGT1A3 (Human) Recombinant Protein