GPRC5B (Human) Recombinant Protein
  • GPRC5B (Human) Recombinant Protein

GPRC5B (Human) Recombinant Protein

Ref: AB-H00051704-G01
GPRC5B (Human) Recombinant Protein

Información del producto

Human GPRC5B full-length ORF (NP_057319.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name GPRC5B
Gene Alias RAIG-2|RAIG2
Gene Description G protein-coupled receptor, family C, group 5, member B
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MFVASERKMRAHQVLTFLLLFVITSVASENASTSRGCGLDLLPQYVSLCDLDAIWGIVVEAVAGAGALITLLLMLILLVRLPFIKEKEKKSPVGLHFLFLLGTLGLFGLTFAFIIQEDETICSVRRFLWGVLFALCFSCLLSQAWRVRRLVRHGTGPAGWQLVGLALCLMLVQVIIAVEWLVLTVLRDTRPACAYEPMDFVMALIYDMVLLVVTLGLALFTLCGKFKRWKLNGAFLLITAFLSVLIWVAWMTMYL
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 51704

Enviar un mensaje


GPRC5B (Human) Recombinant Protein

GPRC5B (Human) Recombinant Protein