Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
GPRC5B (Human) Recombinant Protein
Abnova
GPRC5B (Human) Recombinant Protein
Ref: AB-H00051704-G01
GPRC5B (Human) Recombinant Protein
Contáctenos
Información del producto
Human GPRC5B full-length ORF (NP_057319.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size
2 ug
Gene Name
GPRC5B
Gene Alias
RAIG-2|RAIG2
Gene Description
G protein-coupled receptor, family C, group 5, member B
Storage Conditions
Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key
AP
Immunogen Prot. Seq
MFVASERKMRAHQVLTFLLLFVITSVASENASTSRGCGLDLLPQYVSLCDLDAIWGIVVEAVAGAGALITLLLMLILLVRLPFIKEKEKKSPVGLHFLFLLGTLGLFGLTFAFIIQEDETICSVRRFLWGVLFALCFSCLLSQAWRVRRLVRHGTGPAGWQLVGLALCLMLVQVIIAVEWLVLTVLRDTRPACAYEPMDFVMALIYDMVLLVVTLGLALFTLCGKFKRWKLNGAFLLITAFLSVLIWVAWMTMYL
Form
Liquid
Recomended Dilution
Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species
Human
Storage Buffer
25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID
51704
Enviar un mensaje
GPRC5B (Human) Recombinant Protein
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*