ADIPOR1 (Human) Recombinant Protein (P01)
  • ADIPOR1 (Human) Recombinant Protein (P01)

ADIPOR1 (Human) Recombinant Protein (P01)

Ref: AB-H00051094-P01
ADIPOR1 (Human) Recombinant Protein (P01)

Información del producto

Human ADIPOR1 full-length ORF ( NP_057083.2, 1 a.a. - 375 a.a.) recombinant protein with GST-tag at N-terminal.
Información adicional
Size 2 ug
Gene Name ADIPOR1
Gene Alias ACDCR1|CGI-45|CGI45|FLJ25385|FLJ42464|PAQR1|TESBP1A
Gene Description adiponectin receptor 1
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQW
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 51094

Enviar un mensaje


ADIPOR1 (Human) Recombinant Protein (P01)

ADIPOR1 (Human) Recombinant Protein (P01)