NOX4 (Human) Recombinant Protein
  • NOX4 (Human) Recombinant Protein

NOX4 (Human) Recombinant Protein

Ref: AB-H00050507-G01
NOX4 (Human) Recombinant Protein

Información del producto

Human NOX4 full-length ORF (ADZ15621.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name NOX4
Gene Alias KOX|KOX-1|RENOX
Gene Description NADPH oxidase 4
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MAVSWRSWLANEGVKHLCLFIWLSMNVLLFWKTFLLYNQGPEYHYLHQMLGLGLCLSRASASVLNLNCSLILLPMCRTLLAYLRGSQKVPSRRTRRLLDKSRTFHITCGVTICIFSGVHVAAHLVNALNFSVNYSEDFVELNAARYRDEDPRKLLFTTVPGLTGVCMVVVLFLMITASTYAIRVSNYDIFWYTHNLFFVFYMLLTLHVSGGLLKYQTNLDTHPPGCISLNRTSSQNISLPEYFSEHFHEPFPEGF
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 50507

Enviar un mensaje


NOX4 (Human) Recombinant Protein

NOX4 (Human) Recombinant Protein