GPR171 (Human) Recombinant Protein
  • GPR171 (Human) Recombinant Protein

GPR171 (Human) Recombinant Protein

Ref: AB-H00029909-G01
GPR171 (Human) Recombinant Protein

Información del producto

Human GPR171 full-length ORF (NP_037440.2) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name GPR171
Gene Alias H963
Gene Description G protein-coupled receptor 171
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MTNSSFFCPVYKDLEPFTYFFYLVFLVGIIGSCFATWAFIQKNTNHRCVSIYLINLLTADFLLTLALPVKIVVDLGVAPWKLKIFHCQVTACLIYINMYLSIIFLAFVSIDRCLQLTHSCKIYRIQEPGFAKMISTVVWLMVLLIMVPNMMIPIKDIKEKSNVGCMEFKKEFGRNWHLLTNFICVAIFLNFSAIILISNCLVIRQLYRNKDNENYPNVKKALINILLVTTGYIICFVPYHIVRIPYTLSQTEVIT
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 29909

Enviar un mensaje


GPR171 (Human) Recombinant Protein

GPR171 (Human) Recombinant Protein