TNFRSF21 (Human) Recombinant Protein
  • TNFRSF21 (Human) Recombinant Protein

TNFRSF21 (Human) Recombinant Protein

Ref: AB-H00027242-H03
TNFRSF21 (Human) Recombinant Protein

Información del producto

Purified TNFRSF21 (AAH17730.1 89 a.a. - 170 a.a.) human recombinant protein with His-Flag-StrepII tag at C-terminus expressed in human cells.
Información adicional
Size 2 ug
Gene Name TNFRSF21
Gene Alias BM-018|DR6|MGC31965
Gene Description tumor necrosis factor receptor superfamily, member 21
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Concentration &ge
Application Key WB,ELISA,SDS-PAGE,PI
Immunogen Prot. Seq SSCPVGTFTRHENGIEKCHDCSQPCPWPMIEKLPCAALTDRECTCPPGMFQSNATCAPHTVCPVGWGVRKKGTETEDVRCKQ
Form Liquid
Antigen species Target species Human
Quality control testing SDS-PAGE and Western Blot
Storage Buffer 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Host Human HEK293T cells
Gene ID 27242

Enviar un mensaje


TNFRSF21 (Human) Recombinant Protein

TNFRSF21 (Human) Recombinant Protein