GPR81 (Human) Recombinant Protein
  • GPR81 (Human) Recombinant Protein

GPR81 (Human) Recombinant Protein

Ref: AB-H00027198-G01
GPR81 (Human) Recombinant Protein

Información del producto

Human GPR81 full-length ORF (NP_115943.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name GPR81
Gene Alias FKSG80|GPR104|TA-GPCR
Gene Description G protein-coupled receptor 81
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MYNGSCCRIEGDTISQVMPPLLIVAFVLGALGNGVALCGFCFHMKTWKPSTVYLFNLAVADFLLMICLPFRTDYYLRRRHWAFGDIPCRVGLFTLAMNRAGSIVFLTVVAADRYFKVVHPHHAVNTISTRVAAGIVCTLWALVILGTVYLLLENHLCVQETAVSCESFIMESANGWHDIMFQLEFFMPLGIILFCSFKIVWSLRRRQQLARQARMKKATRFIMVVAIVFITCYLPSVSARLYFLWTVPSSACDPS
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 27198

Enviar un mensaje


GPR81 (Human) Recombinant Protein

GPR81 (Human) Recombinant Protein