SIGLEC7 (Human) Recombinant Protein (P01)
  • SIGLEC7 (Human) Recombinant Protein (P01)

SIGLEC7 (Human) Recombinant Protein (P01)

Ref: AB-H00027036-P01
SIGLEC7 (Human) Recombinant Protein (P01)

Información del producto

Human SIGLEC7 full-length ORF ( AAH28150, 1 a.a. - 467 a.a.) recombinant protein with GST-tag at N-terminal.
Información adicional
Size 2 ug
Gene Name SIGLEC7
Gene Alias AIRM1|CD328|CDw328|D-siglec|QA79|SIGLEC-7|p75|p75/AIRM1
Gene Description sialic acid binding Ig-like lectin 7
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MLLLLLLPLLWGRERVEGQKSNRKDYSLTMQSSVTVQEGMCVHVRCSFSYPVDSQTDSDPVHGYWFRAGNDISWKAPVATNNPAWAVQEETRDRFHLLGDPQTKNCTLSIRDARMSDAGRYFFRMEKGNIKWNYKYDQLSVNVTALTHRPNILIPGTLESGCFQNLTCSVPWACEQGTPPMISWMGTSVSPLHPSTTRSSVLTLIPQPQHHGTSLTCQVTLPGAGVTTNRTIQLNVSYPPQNLTVTVFQGEGTAS
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 27036

Enviar un mensaje


SIGLEC7 (Human) Recombinant Protein (P01)

SIGLEC7 (Human) Recombinant Protein (P01)