OR7A5 (Human) Recombinant Protein
  • OR7A5 (Human) Recombinant Protein

OR7A5 (Human) Recombinant Protein

Ref: AB-H00026659-G01
OR7A5 (Human) Recombinant Protein

Información del producto

Human OR7A5 full-length ORF (NP_059976.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name OR7A5
Gene Alias HTPCR2
Gene Description olfactory receptor, family 7, subfamily A, member 5
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MEPGNDTQISEFLLLGFSQEPGLQPFLFGLFLSMYLVTVLGNLLIILATISDSHLHTPMYFFLSNLSFADICVTSTTIPKMLMNIQTQNKVITYIACLMQMYFFILFAGFENFLLSVMAYDRFVAICHPLHYMVIMNPHLCGLLVLASWTMSALYSLLQILMVVRLSFCTALEIPHFFCELNQVIQLACSDSFLNHMVIYFTVALLGGGPLTGILYSYSKIISSIHAISSAQGKYKAFSTCASHLSVVSLFYGAI
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 26659

Enviar un mensaje


OR7A5 (Human) Recombinant Protein

OR7A5 (Human) Recombinant Protein