OR11A1 (Human) Recombinant Protein
  • OR11A1 (Human) Recombinant Protein

OR11A1 (Human) Recombinant Protein

Ref: AB-H00026531-G01
OR11A1 (Human) Recombinant Protein

Información del producto

Human OR11A1 full-length ORF (NP_039225.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name OR11A1
Gene Alias OR11A2|dJ994E9.6|hs6M1-18
Gene Description olfactory receptor, family 11, subfamily A, member 1
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MEIVSTGNETITEFVLLGFYDIPELHFLFFIVFTAVYVFIIIGNMLIIVAVVSSQRLHKPMYIFLANLSFLDILYTSAVMPKMLEGFLQEATISVAGCLLQFFIFGSLATAECLLLAVMAYDRYLAICYPLHYPLLMGPRRYMGLVVTTWLSGFVVDGLVVALVAQLRFCGPNHIDQFYCDFMLFVGLACSDPRVAQVTTLILSVFCLTIPFGLILTSYARIVVAVLRVPAGASRRRAFSTCSSHLAVVTTFYGT
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 26531

Enviar un mensaje


OR11A1 (Human) Recombinant Protein

OR11A1 (Human) Recombinant Protein