OR12D2 (Human) Recombinant Protein
  • OR12D2 (Human) Recombinant Protein

OR12D2 (Human) Recombinant Protein

Ref: AB-H00026529-G01
OR12D2 (Human) Recombinant Protein

Información del producto

Human OR12D2 full-length ORF (AAH69123.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name OR12D2
Gene Alias DJ994E9.8|HS6M1-20|MGC126791|MGC126795
Gene Description olfactory receptor, family 12, subfamily D, member 2
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MLNTTSVTEFLLLGVTDIQELQPFLFVVFLTIYFISVTGNGAVLMIVISDPRLHSLMYFFLGNLSYLDICYSTVTLPKMLQNFLSTHKAISFLGCISQLHFFHFLGSTESMLFAVMAFDLSVAICKPLRYTVIMNPQLCTQMAITIWVIGFFHALLHSVMTSRLNFCGSNRIHHFLCDIKPLLKLACGNTELNQWLLSTVTGTIAMGPFFLTLLSYFYIITYLFFKTRSCSMLCKALSTCASHFMVVILFYAPVL
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 26529

Enviar un mensaje


OR12D2 (Human) Recombinant Protein

OR12D2 (Human) Recombinant Protein