OR1A2 (Human) Recombinant Protein
  • OR1A2 (Human) Recombinant Protein

OR1A2 (Human) Recombinant Protein

Ref: AB-H00026189-G01
OR1A2 (Human) Recombinant Protein

Información del producto

Human OR1A2 full-length ORF (NP_036484.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name OR1A2
Gene Alias MGC119930|MGC119931|OR17-6
Gene Description olfactory receptor, family 1, subfamily A, member 2
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MKKENQSFNLDFILLGVTSQQEQNNVFFVIFLCIYPITLTGNLLIILAICADIRLHNPMYFLLANLSLVDIIFSSVTIPKVLANHLLGSKFISFGGCLMQMYFMIALAKADSYTLAAMAYDRAVAISCPLHYTTIMSPRSCILLIAGSWVIGNTSALPHTLLTASLSFCGNQEVANFYCDIMPLLKLSCSDVHFNVKMMYLGVGVFSLPLLCIIVSYVQVFSTVFQVPSTKSLFKAFCTCGSHLTVVFLYYGTTM
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 26189

Enviar un mensaje


OR1A2 (Human) Recombinant Protein

OR1A2 (Human) Recombinant Protein