TARDBP (Human) Recombinant Protein (P02)
  • TARDBP (Human) Recombinant Protein (P02)

TARDBP (Human) Recombinant Protein (P02)

Ref: AB-H00023435-P02
TARDBP (Human) Recombinant Protein (P02)

Información del producto

Human TARDBP full-length ORF (NP_031401.1, 1 a.a. - 414 a.a.) recombinant protein with GST tag at N-terminal.
Información adicional
Size 2 ug
Gene Name TARDBP
Gene Alias ALS10|TDP-43
Gene Description TAR DNA binding protein
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISV
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 23435

Enviar un mensaje


TARDBP (Human) Recombinant Protein (P02)

TARDBP (Human) Recombinant Protein (P02)