LILRB1 (Human) Recombinant Protein
  • LILRB1 (Human) Recombinant Protein

LILRB1 (Human) Recombinant Protein

Ref: AB-H00010859-G01
LILRB1 (Human) Recombinant Protein

Información del producto

Human LILRB1 full-length ORF (AAH15731.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name LILRB1
Gene Alias CD85|CD85J|FLJ37515|ILT2|LIR-1|LIR1|MIR-7|MIR7
Gene Description leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 1
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MTPILTVLICLGLSLGPRTHVQAGHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTAPWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSDTAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVTLQCDSQVAFDGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEETLTLQCGSDAGYNRF
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 10859

Enviar un mensaje


LILRB1 (Human) Recombinant Protein

LILRB1 (Human) Recombinant Protein