CYSLTR1 (Human) Recombinant Protein
  • CYSLTR1 (Human) Recombinant Protein

CYSLTR1 (Human) Recombinant Protein

Ref: AB-H00010800-G01
CYSLTR1 (Human) Recombinant Protein

Información del producto

Human CYSLTR1 full-length ORF (NP_006630.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name CYSLTR1
Gene Alias CYSLT1|CYSLT1R|CYSLTR|HG55|HMTMF81|MGC46139
Gene Description cysteinyl leukotriene receptor 1
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQVYMINLAVADLLCVCTLPLRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCIAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSPFLMAKPQKDEKNNTKCFEPPQDNQTKNHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKKSMKKNLSSHKKAIGMIMVVTAAFLVSFMPYHIQRTI
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 10800

Enviar un mensaje


CYSLTR1 (Human) Recombinant Protein

CYSLTR1 (Human) Recombinant Protein