CLEC10A (Human) Recombinant Protein
  • CLEC10A (Human) Recombinant Protein

CLEC10A (Human) Recombinant Protein

Ref: AB-H00010462-G01
CLEC10A (Human) Recombinant Protein

Información del producto

Human CLEC10A full-length ORF (NP_878910.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name CLEC10A
Gene Alias CD301|CLECSF13|CLECSF14|HML|HML2
Gene Description C-type lectin domain family 10, member A
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MTRTYENFQYLENKVKVQGFKNGPLPLQSLLQRLCSGPCHLLLSLGLGLLLLVIICVVGFQNSKFQRDLVTLRTDFSNFTSNTVAEIQALTSQGSSLEETIASLKAEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPSVCVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNASTEGTCCPVNWVEHQDSCYWFSHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTD
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 10462

Enviar un mensaje


CLEC10A (Human) Recombinant Protein

CLEC10A (Human) Recombinant Protein