P2RY5 (Human) Recombinant Protein
  • P2RY5 (Human) Recombinant Protein

P2RY5 (Human) Recombinant Protein

Ref: AB-H00010161-G01
P2RY5 (Human) Recombinant Protein

Información del producto

Human P2RY5 full-length ORF (NP_005758.2) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name P2RY5
Gene Alias LAH3|MGC120358|P2Y5
Gene Description purinergic receptor P2Y, G-protein coupled, 5
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MVSVNSSHCFYNDSFKYTLYGCMFSMVFVLGLISNCVAIYIFICVLKVRNETTTYMINLAMSDLLFVFTLPFRIFYFTTRNWPFGDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVYPFKSKTLRTKRNAKIVCTGVWLTVIGGSAPAVFVQSTHSQGNNASEACFENFPEATWKTYLSRIVIFIEIVGFFIPLILNVTCSSMVLKTLTKPVTLSRSKINKTKVLKMIFVHLIIFCFCFVPYNINLILYSLV
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 10161

Enviar un mensaje


P2RY5 (Human) Recombinant Protein

P2RY5 (Human) Recombinant Protein