HTR3B (Human) Recombinant Protein Ver mas grande

HTR3B (Human) Recombinant Protein

AB-H00009177-G01

Producto nuevo

HTR3B (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 5 Biopuntos. Su cesta contiene un total 5 Biopuntos puede ser convertido en un Biobonos Descuento 20.00EUR.


Hoja técnica

Size 10 ug
Gene Name HTR3B
Gene Alias 5-HT3B
Gene Description 5-hydroxytryptamine (serotonin) receptor 3B
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MLSSVMAPLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKATTVYLDLFVHAILDVDAENQILKTSVWYQEVWNDEFLSWNSSMFDEIREISLPLSAIWAPDIIINEFVDIERYPDLPYVYVNSSGTIENYKPIQVVSACSLETYAFPFDVQNCSLTFKSILHTVEDVDLAFLRSPEDIQHDKKAFLNDSEWELLSVSSTYSILQSSAGGFAQIQFNVVMRRHPLVYVVSLLIPSIFLML
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 9177

Más información

Human HTR3B full-length ORF (NP_006019.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).

Consulta sobre un producto

HTR3B (Human) Recombinant Protein

HTR3B (Human) Recombinant Protein