LPAR2 (Human) Recombinant Protein
  • LPAR2 (Human) Recombinant Protein

LPAR2 (Human) Recombinant Protein

Ref: AB-H00009170-G01
LPAR2 (Human) Recombinant Protein

Información del producto

Human LPAR2 full-length ORF (NP_004711.2) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name LPAR2
Gene Alias EDG-4|EDG4|FLJ93869|LPA2
Gene Description lysophosphatidic acid receptor 2
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MVIMGQCYYNETIGFFYNNSGKELSSHWRPKDVVVVALGLTVSVLVLLTNLLVIAAIASNRRFHQPIYYLLGNLAAADLFAGVAYLFLMFHTGPRTARLSLEGWFLRQGLLDTSLTASVATLLAIAVERHRSVMAVQLHSRLPRGRVVMLIVGVWVAALGLGLLPAHSWHCLCALDRCSRMAPLLSRSYLAVWALSSLLVFLLMVAVYTRIFFYVRRRVQRMAEHVSCHPRYRETTLSLVKTVVIILGAFVVCWT
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 9170

Enviar un mensaje


LPAR2 (Human) Recombinant Protein

LPAR2 (Human) Recombinant Protein