TNFSF18 (Human) Recombinant Protein
  • TNFSF18 (Human) Recombinant Protein

TNFSF18 (Human) Recombinant Protein

Ref: AB-H00008995-H01
TNFSF18 (Human) Recombinant Protein

Información del producto

Purified TNFSF18 (AAH69111.1 50 a.a. - 177 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
Información adicional
Size 25 ug
Gene Name TNFSF18
Gene Alias AITRL|GITRL|MGC138237|TL6|hGITRL
Gene Description tumor necrosis factor (ligand) superfamily, member 18
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Concentration &ge
Application Key WB,ELISA,SDS-PAGE,PI
Immunogen Prot. Seq QLETAKEPCMAKFGPLPSKWQMASSEPPCVNKVSDWKLEILQNGLYLIYGQVAPNANYNDVAPFEVRLYKNKDMIQTLTNKSKIQNVGGTYELHVGDTIDLIFNSEHQVLKNNTYWGIILLANPQFIS
Form Liquid
Antigen species Target species Human
Quality control testing SDS-PAGE and Western Blot
Storage Buffer 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Host Human HEK293T cells
Gene ID 8995

Enviar un mensaje


TNFSF18 (Human) Recombinant Protein

TNFSF18 (Human) Recombinant Protein