PROM1 (Human) Recombinant Protein
  • PROM1 (Human) Recombinant Protein

PROM1 (Human) Recombinant Protein

Ref: AB-H00008842-G01
PROM1 (Human) Recombinant Protein

Información del producto

Human PROM1 full-length ORF (AAH12089.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name PROM1
Gene Alias AC133|CD133|MSTP061|PROML1|RP41
Gene Description prominin 1
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MALVLGSLLLLGLCGNSFSGGQPSSTDAPKAWNYELPATNYETQDSHKAGPIGILFELVHIFLYVVQPRDFPEDTLRKFLQKAYESKIDYDKIVYYEAGIILCCVLGLLFIILMPLVGYFFCMCRCCNKCGGEMHQRQKENGPFLRKCFAISLLVICIIISIGIFYGFVANHQVRTRIKRSRKLADSNFKDLRTLLNETPEQIKYILAQYNTTKDKAFTDLNSINSVLGGGILDRLRPNIIPVLDEIKSMATAIK
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 8842

Enviar un mensaje


PROM1 (Human) Recombinant Protein

PROM1 (Human) Recombinant Protein