TNFRSF14 (Human) Recombinant Protein
  • TNFRSF14 (Human) Recombinant Protein

TNFRSF14 (Human) Recombinant Protein

Ref: AB-H00008764-G01
TNFRSF14 (Human) Recombinant Protein

Información del producto

Human TNFRSF14 full-length ORF (NP_003811.2) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name TNFRSF14
Gene Alias ATAR|HVEA|HVEM|LIGHTR|TR2
Gene Description tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator)
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MEPPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWVWWFLSGSLVIVIVCSTVGLIICVKRRKPRGDVVKVIVSVQRKRQEAEGEATVI
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 8764

Enviar un mensaje


TNFRSF14 (Human) Recombinant Protein

TNFRSF14 (Human) Recombinant Protein