Ver mas grande
TNFSF12 (Human) Recombinant Protein
AB-H00008742-H01
Producto nuevo
TNFSF12 (Human) Recombinant Protein
Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.
Hoja técnica
| Size | 2 ug |
| Gene Name | TNFSF12 |
| Gene Alias | APO3L|DR3LG|MGC129581|MGC20669|TWEAK |
| Gene Description | tumor necrosis factor (ligand) superfamily, member 12 |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Concentration | &ge |
| Application Key | WB,ELISA,SDS-PAGE,PI |
| Immunogen Prot. Seq | AIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | SDS-PAGE and Western Blot |
| Storage Buffer | 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin. |
| Host | Human HEK293T cells |
| Gene ID | 8742 |
Más información
Purified TNFSF12 (NP_003800.1 106 a.a. - 249 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.