TAF15 (Human) Recombinant Protein (P02) Ver mas grande

TAF15 (Human) Recombinant Protein (P02)

AB-H00008148-P02

Producto nuevo

TAF15 (Human) Recombinant Protein (P02)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 2 ug
Gene Name TAF15
Gene Alias Npl3|RBP56|TAF2N|TAFII68|hTAFII68
Gene Description TAF15 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 68kDa
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MSDSGSYGQSGGEQQSYSTYGNPGSQGYGQASQSYSGYGQTTDSSYGQNYSGYSSYGQSYSQSYGGYENQKQSSYSQQPYNNQGQQQNMESSGSQGGRAPSYDQPDYGQQDSYDQQSGYDQHQGSYDEQSNYDQQHDSYSQNQQSYHSQRENYSHHTQDDRRDVSRYGEDNRGYGGSQGGGRGRGGYDKDGRGPMTGSSGGDRGGFKNFGGHRDYGPRTDADSESDNSDNNTIFVQGLGEGVSTDQVGEFFKQIG
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 8148

Más información

Human TAF15 full-length ORF (BAG36034.1, 1 a.a. - 589 a.a.) recombinant protein with GST tag at N-terminal.

Consulta sobre un producto

TAF15 (Human) Recombinant Protein (P02)

TAF15 (Human) Recombinant Protein (P02)