Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
TAF15 (Human) Recombinant Protein (P02)
Abnova
TAF15 (Human) Recombinant Protein (P02)
Ref: AB-H00008148-P02
TAF15 (Human) Recombinant Protein (P02)
Contáctenos
Información del producto
Human TAF15 full-length ORF (BAG36034.1, 1 a.a. - 589 a.a.) recombinant protein with GST tag at N-terminal.
Información adicional
Size
2 ug
Gene Name
TAF15
Gene Alias
Npl3|RBP56|TAF2N|TAFII68|hTAFII68
Gene Description
TAF15 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 68kDa
Storage Conditions
Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key
ELISA,WB-Re,AP,Array
Immunogen Prot. Seq
MSDSGSYGQSGGEQQSYSTYGNPGSQGYGQASQSYSGYGQTTDSSYGQNYSGYSSYGQSYSQSYGGYENQKQSSYSQQPYNNQGQQQNMESSGSQGGRAPSYDQPDYGQQDSYDQQSGYDQHQGSYDEQSNYDQQHDSYSQNQQSYHSQRENYSHHTQDDRRDVSRYGEDNRGYGGSQGGGRGRGGYDKDGRGPMTGSSGGDRGGFKNFGGHRDYGPRTDADSESDNSDNNTIFVQGLGEGVSTDQVGEFFKQIG
Antigen species Target species
Human
Quality control testing
12.5% SDS-PAGE Stained with Coomassie Blue
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID
8148
Enviar un mensaje
TAF15 (Human) Recombinant Protein (P02)
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*