Ver mas grande
TAF15 (Human) Recombinant Protein (P02)
AB-H00008148-P02
Producto nuevo
TAF15 (Human) Recombinant Protein (P02)
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 2 ug |
| Gene Name | TAF15 |
| Gene Alias | Npl3|RBP56|TAF2N|TAFII68|hTAFII68 |
| Gene Description | TAF15 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 68kDa |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Application Key | ELISA,WB-Re,AP,Array |
| Immunogen Prot. Seq | MSDSGSYGQSGGEQQSYSTYGNPGSQGYGQASQSYSGYGQTTDSSYGQNYSGYSSYGQSYSQSYGGYENQKQSSYSQQPYNNQGQQQNMESSGSQGGRAPSYDQPDYGQQDSYDQQSGYDQHQGSYDEQSNYDQQHDSYSQNQQSYHSQRENYSHHTQDDRRDVSRYGEDNRGYGGSQGGGRGRGGYDKDGRGPMTGSSGGDRGGFKNFGGHRDYGPRTDADSESDNSDNNTIFVQGLGEGVSTDQVGEFFKQIG |
| Antigen species Target species | Human |
| Quality control testing | 12.5% SDS-PAGE Stained with Coomassie Blue |
| Storage Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID | 8148 |
Más información
Human TAF15 full-length ORF (BAG36034.1, 1 a.a. - 589 a.a.) recombinant protein with GST tag at N-terminal.