CXCR4 (Human) Recombinant Protein (P01)
  • CXCR4 (Human) Recombinant Protein (P01)

CXCR4 (Human) Recombinant Protein (P01)

Ref: AB-H00007852-P01
CXCR4 (Human) Recombinant Protein (P01)

Información del producto

Human CXCR4 full-length ORF ( AAH20968.1, 1 a.a. - 352 a.a.) recombinant protein with GST-tag at N-terminal.
Información adicional
Size 2 ug
Gene Name CXCR4
Gene Alias CD184|D2S201E|FB22|HM89|HSY3RR|LAP3|LCR1|LESTR|NPY3R|NPYR|NPYRL|NPYY3R|WHIM
Gene Description chemokine (C-X-C motif) receptor 4
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKTTVILILAFFACWLPY
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 7852

Enviar un mensaje


CXCR4 (Human) Recombinant Protein (P01)

CXCR4 (Human) Recombinant Protein (P01)