XK (Human) Recombinant Protein
  • XK (Human) Recombinant Protein

XK (Human) Recombinant Protein

Ref: AB-H00007504-G01
XK (Human) Recombinant Protein

Información del producto

Human XK full-length ORF (AAH36019.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name XK
Gene Alias KX|X1k|XKR1
Gene Description X-linked Kx blood group (McLeod syndrome)
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MKFPASVLASVFLFVAETTAALSLSSTYRSGGDRMWQALTLLFSLLPCALVQLTLLFVHRDLSRDRPLVLLLHLLQLGPLFRCFEVFCIYFQSGNNEEPYVSITKKRQMPKNGLSEEIEKEVGQAEGKLITHRSAFSRASVIQAFLGSAPQLTLQLYISVMQQDVTVGRSLLMTISLLSIVYGALRCNILAIKIKYDEYEVKVKPLAYVCIFLWRSFEIATRVVVLVLFTSVLKTWVVVIILINFFSLFLYPWIL
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 7504

Enviar un mensaje


XK (Human) Recombinant Protein

XK (Human) Recombinant Protein