VIPR1 (Human) Recombinant Protein (P01)
  • VIPR1 (Human) Recombinant Protein (P01)

VIPR1 (Human) Recombinant Protein (P01)

Ref: AB-H00007433-P01
VIPR1 (Human) Recombinant Protein (P01)

Información del producto

Human VIPR1 full-length ORF ( AAH64424.1, 1 a.a. - 457 a.a.) recombinant protein with GST-tag at N-terminal.
Información adicional
Size 2 ug
Gene Name VIPR1
Gene Alias FLJ41949|HVR1|II|PACAP-R-2|RDC1|VAPC1|VIPR|VIRG|VPAC1|VPCAP1R
Gene Description vasoactive intestinal peptide receptor 1
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MRPPSPLPARWLCVLAGALAWALGPAGGQAARLQEECDYVQMIEVQHKQCLEEAQLENETIGCSKMWDNLTCWPATPRGQVVVLACPLIFKLFSSIQGRNVSRSCTDEGWTHLEPGPYPIACGLDDKAASLDEQQTMFYGSVKTGYTIGYGLSLATLLVATAILSLFRKLHCTRNYIHMHLFISFILRAAAVFIKDLALFDSGESDQCSEGSVGCKAAMVFFQYCVMANFFWLLVEGLYLYTLLAVSFFSERKYF
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 7433

Enviar un mensaje


VIPR1 (Human) Recombinant Protein (P01)

VIPR1 (Human) Recombinant Protein (P01)