VCAM1 (Human) Recombinant Protein
  • VCAM1 (Human) Recombinant Protein

VCAM1 (Human) Recombinant Protein

Ref: AB-H00007412-G01
VCAM1 (Human) Recombinant Protein

Información del producto

Human VCAM1 full-length ORF (NP_001069.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name VCAM1
Gene Alias CD106|DKFZp779G2333|INCAM-100|MGC99561
Gene Description vascular cell adhesion molecule 1
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MPGKMVVILGASNILWIMFAASQAFKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWRTQIDSPLNGKVTNEGTTSTLTMNPVSFGNEHSYLCTATCESRKLEKGIQVEIYSFPKDPEIHLSGPLEAGKPITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVIEDIGKVLVCRAKLHIDEMDSVPTVRQAVKELQVYISPKNTVISVNPSTKLQEGGSVTMTCSSEGLPAPE
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 7412

Enviar un mensaje


VCAM1 (Human) Recombinant Protein

VCAM1 (Human) Recombinant Protein