TLR1 (Human) Recombinant Protein Ver mas grande

TLR1 (Human) Recombinant Protein

AB-H00007096-G01

Producto nuevo

TLR1 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 5 Biopuntos. Su cesta contiene un total 5 Biopuntos puede ser convertido en un Biobonos Descuento 20.00EUR.


Hoja técnica

Size 10 ug
Gene Name TLR1
Gene Alias CD281|DKFZp547I0610|DKFZp564I0682|KIAA0012|MGC104956|MGC126311|MGC126312|TIL|rsc786
Gene Description toll-like receptor 1
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MTSIFHFAIIFMLILQIRIQLSEESEFLVDRSKNGLIHVPKDLSQKTTILNISQNYISELWTSDILSLSKLRILIISHNRIQYLDISVFKFNQELEYLDLSHNKLVKISCHPTVNLKHLDLSFNAFDALPICKEFGNMSQLKFLGLSTTHLEKSSVLPIAHLNISKVLLVLGETYGEKEDPEGLQDFNTESLHIVFPTNKEFHFILDVSVKTVANLELSNIKCVLEDNKCSYFLSILAKLQTNPKLSNLTLNNIE
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 7096

Más información

Human TLR1 full-length ORF (NP_003254.2) recombinant protein without tag.
This product is belong to Proteoliposome (PL).

Consulta sobre un producto

TLR1 (Human) Recombinant Protein

TLR1 (Human) Recombinant Protein