SP4 (Human) Recombinant Protein (P01)
  • SP4 (Human) Recombinant Protein (P01)

SP4 (Human) Recombinant Protein (P01)

Ref: AB-H00006671-P01
SP4 (Human) Recombinant Protein (P01)

Información del producto

Human SP4 full-length ORF (ABZ92432.1, 1 a.a. - 784 a.a.) recombinant protein with GST tag at N-terminal.
Información adicional
Size 2 ug
Gene Name SP4
Gene Alias HF1B|MGC130008|MGC130009|SPR-1
Gene Description Sp4 transcription factor
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MSDQKKEEEEEAAAAAAMATEGGKTSEPENNNKKPKTSGSQDSQPSPLALLAATCSKIGTPGENQATGQQQIIIDPSQGLVQLQNQPQQLELVTTQLAGNAWQLVASTPPASKENNVSQPASSSSSSSSSNNGSASPTKTKSGNSSTPGQFQVIQVQNPSGSVQYQVIPQLQTVEGQQIQINPTSSSSLQDLQGQIQLISAGNNQAILTAANRTASGNILAQNLANQTVPVQIRPGVSIPLQLQTLPGTQAQVVT
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 6671

Enviar un mensaje


SP4 (Human) Recombinant Protein (P01)

SP4 (Human) Recombinant Protein (P01)