AB-H00006566-P01
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Size | 2 ug |
Gene Name | SLC16A1 |
Gene Alias | FLJ36745|HHF7|MCT|MCT1|MGC44475 |
Gene Description | solute carrier family 16, member 1 (monocarboxylic acid transporter 1) |
Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
Application Key | ELISA,WB-Re,AP,Array |
Immunogen Prot. Seq | MPPAVGGPVGYTPPDGGWGWAVVIGAFISIGFSYAFPKSITVFFKEIEGIFHATTSEVSWISSIMLAVMYGGGPISSILVNKYGSRIVMIVGGCLSGCGLIAASFCNTVQQLYVCIGVIGGLGLAFNLNPALTMIGKYFYKRRPLANGLAMAGSPVFLCTLAPLNQVFFGIFGWRGSFLILGGLLLNCCVAGALMRPIGPKPTKAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQFLDL |
Antigen species Target species | Human |
Quality control testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Storage Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene ID | 6566 |