SELP (Human) Recombinant Protein
  • SELP (Human) Recombinant Protein

SELP (Human) Recombinant Protein

Ref: AB-H00006403-G01
SELP (Human) Recombinant Protein

Información del producto

Human SELP full-length ORF (AAH68533.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name SELP
Gene Alias CD62|CD62P|FLJ45155|GMP140|GRMP|LECAM3|PADGEM|PSEL
Gene Description selectin P (granule membrane protein 140kDa, antigen CD62)
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MANCQIAILYQRFQRVVFGISQLLCFSALISELTNQKEVAAWTYHYSTKAYSWNISRKYCQNRYTDLVAIQNKNEIDYLNKVLPYYSSYYWIGIRKNNKTWTWVGTKKALTNEAENWADNEPNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALCYTASCQDMSCSKQGECLETIGNYTCSCYPGFYGPECEYVRECGELELPQHVLMNCSHPLGNFSFNSQCSFHCTDGYQVNGPSKLECLASGIWTNKPP
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 6403

Enviar un mensaje


SELP (Human) Recombinant Protein

SELP (Human) Recombinant Protein