SELE (Human) Recombinant Protein
  • SELE (Human) Recombinant Protein

SELE (Human) Recombinant Protein

Ref: AB-H00006401-G01
SELE (Human) Recombinant Protein

Información del producto

Human SELE full-length ORF (NP_000441.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name SELE
Gene Alias CD62E|ELAM|ELAM1|ESEL|LECAM2
Gene Description selectin E
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MIASQFLSALTLVLLIKESGAWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVEC
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 6401

Enviar un mensaje


SELE (Human) Recombinant Protein

SELE (Human) Recombinant Protein