PRPH2 (Human) Recombinant Protein
  • PRPH2 (Human) Recombinant Protein

PRPH2 (Human) Recombinant Protein

Ref: AB-H00005961-G01
PRPH2 (Human) Recombinant Protein

Información del producto

Human PRPH2 full-length ORF (AAH74720.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name PRPH2
Gene Alias AOFMD|AVMD|PRPH|RDS|RP7|TSPAN22|rd2
Gene Description peripherin 2 (retinal degeneration, slow)
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MALLKVKFDQKKRVKLAQGLWLMNWFSVLAGIIIFSLGLFLKIGLRKRSDVMNNSESHFVPNSLIGMGVLSCVFNSLAGKICYDALDPAKYARWKPWLKPYLAICVLFNIILFLVALCCFLLRGSLENTLGQGLKNGMKYYRDTDTPGRCFMKKTIDMLQIEFKCCGNNGFRDWFEIQWISNRYLDFSSKEVKDRIKSNVDGRYLVDGVPFSCCNPSSPRPCIQYQITNNSAHYSYDHQTEELNLWVRGCRAALL
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 5961

Enviar un mensaje


PRPH2 (Human) Recombinant Protein

PRPH2 (Human) Recombinant Protein